| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TADA3L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TADA3L Antibody from Novus Biologicals is a rabbit polyclonal antibody to TADA3L. This antibody reacts with human, mouse, rat. The TADA3L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat TADA3L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG |
|---|
| Other Names | ADA3ADA3 homolog, FLJ20221, FLJ21329, hADA3ADA3-like protein, NGG1, STAF54, TADA3Ltranscriptional adaptor 3 (NGG1 homolog, yeast)-like, transcriptional adapter 3, Transcriptional adapter 3-like, transcriptional adaptor 3 |
|---|
| Gene, Accession # | TADA3, Gene ID: 10474 |
|---|
| Catalog # | NBP1-90243 |
|---|
| Price | |
|---|
| Order / More Info | TADA3L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261, 29670108 |
|---|
| 产品资料 |
|
|