| Edit |   |
|---|
| Antigenic Specificity | Rab1A |
|---|
| Clone | 3F10 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgM kappa |
|---|
| Format | unpurified, no preservative |
|---|
| Size | 0.2 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Rab1A Antibody (3F10) from Novus Biologicals is a mouse monoclonal antibody to Rab1A. This antibody reacts with human. The Rab1A Antibody (3F10) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | RAB1A (NP_004152.1, 106 a.a. - 204 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC |
|---|
| Other Names | DKFZp564B163, member RAS oncogene family, RAB1A, member RAS oncogene family, ras-related protein Rab-1A |
|---|
| Gene, Accession # | RAB1A, Gene ID: 5861, Accession: NP_004152.1, SwissProt: NP_004152.1 |
|---|
| Catalog # | H00005861-M07A |
|---|
| Price | |
|---|
| Order / More Info | Rab1A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 21551065, 25446900 |
|---|