| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DCI |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DCI Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCI. This antibody reacts with human. The DCI Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DCI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGSQRVLVEPDAGAGVAVMKFKNPPVNSLSLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRS |
|---|
| Other Names | acetylene-allene isomerase, D2-enoyl-CoA isomerase, D3, DCI3,2-trans-enoyl-CoA isomerase3,2 trans-enoyl-CoA isomerase, Delta(2)-enoyl-CoA isomerase, Delta(3), delta3, delta2-enoyl-CoA isomerase, dodecenoyl-CoA delta isomerase (3,2 trans-enoyl-CoA isomerase), dodecenoyl-CoA isomerase3,2-trans-enoyl-CoA isomerase, mitochondrial, dodecenoyl-Coenzyme A delta isomerase (3,2 trans-enoyl-Coenzyme A isomerase), EC 5.3.3.8, enoyl-CoA delta isomerase 13,2 trans-enoyl-Coenzyme A isomerase |
|---|
| Gene, Accession # | ECI1, Gene ID: 1632 |
|---|
| Catalog # | NBP1-91822 |
|---|
| Price | |
|---|
| Order / More Info | DCI Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|