| Edit |   |
|---|
| Antigenic Specificity | DCDC2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DCDC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCDC2. This antibody reacts with mouse. The DCDC2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human Dcdc2a. Peptide sequence QIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVS. |
|---|
| Other Names | DCDC2A, doublecortin domain containing 2, KIAA1154Protein RU2S, RU2doublecortin domain-containing protein 2, RU2S |
|---|
| Gene, Accession # | DCDC2, Gene ID: 51473, Accession: NP_808245 |
|---|
| Catalog # | NBP1-79649 |
|---|
| Price | |
|---|
| Order / More Info | DCDC2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|