| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DCC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DCC Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCC. This antibody reacts with human. The DCC Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human DCC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSN |
|---|
| Other Names | Colorectal cancer suppressor, CRC18, CRCR1, deleted in colorectal cancer protein, deleted in colorectal carcinoma, IGDCC1colorectal tumor suppressor, Immunoglobulin superfamily DCC subclass member 1, immunoglobulin superfamily, DCC subclass, member 1, netrin receptor DCC, Tumor suppressor protein DCC |
|---|
| Gene, Accession # | DCC, Gene ID: 1630 |
|---|
| Catalog # | NBP2-56793 |
|---|
| Price | |
|---|
| Order / More Info | DCC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|