| Edit |   |
|---|
| Antigenic Specificity | DCBLD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DCBLD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCBLD1. This antibody reacts with human. The DCBLD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human DCBLD1The immunogen for this antibody is DCBLD1. Peptide sequence TITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGSMTVPKE. |
|---|
| Other Names | discoidin, CUB and LCCL domain containing 1, discoidin, CUB and LCCL domain-containing protein 1, MGC46341 |
|---|
| Gene, Accession # | DCBLD1, Gene ID: 285761, Accession: NP_775945, SwissProt: NP_775945 |
|---|
| Catalog # | NBP1-79601 |
|---|
| Price | |
|---|
| Order / More Info | DCBLD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|