| Edit |   |
| Antigenic Specificity | DCAF12L2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DCAF12L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCAF12L2. This antibody reacts with human. The DCAF12L2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DCAF12L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SIAWHSEVGLPVYAHIRPRDVEAIPRASTNPSNRKVRAL |
| Other Names | DDB1 And CUL4 Associated Factor 12-Like 2, DDB1- And CUL4-Associated Factor 12-Like Protein 2, WD Repeat Domain 40C, WD Repeat-Containing Protein 40C, WDR40C |
| Gene, Accession # | DCAF12L2, Gene ID: 340578, Accession: Q5VW00, SwissProt: Q5VW00 |
| Catalog # | NBP2-33676 |
| Price | |
| Order / More Info | DCAF12L2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |