| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LAT |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LAT Antibody from Novus Biologicals is a rabbit polyclonal antibody to LAT. This antibody reacts with human. The LAT Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDG |
|---|
| Other Names | 36 kDa phospho-tyrosine adapter protein, LAT1,36 kDa phospho-tyrosine adaptor protein, linker for activation of T cells, linker for activation of T-cells family member 1, p36-38, pp36 |
|---|
| Gene, Accession # | LAT, Gene ID: 27040 |
|---|
| Catalog # | NBP1-81324 |
|---|
| Price | |
|---|
| Order / More Info | LAT Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|