| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | LASS1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LASS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LASS1. This antibody reacts with human. The LASS1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human LASS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLTGQVHELKDLREYDTAEAQSLKPSKAEKPLRNGLVKDKRF |
|---|
| Other Names | CerS1, LAG1 homolog, ceramide synthase 1, LAG1 longevity assurance homolog 1, LAG1MGC90349, longevity assurance (LAG1, S. cerevisiae) homolog 1, Longevity assurance gene 1 protein homolog 1, Protein UOG-1, UOG1LAG1 longevity assurance homolog 1 (S. cerevisiae), upstream of GDF1 |
|---|
| Gene, Accession # | CERS1, Gene ID: 10715 |
|---|
| Catalog # | NBP1-92067 |
|---|
| Price | |
|---|
| Order / More Info | LASS1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|