| Edit |   |
| Antigenic Specificity | PSF2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PSF2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PSF2. This antibody reacts with human. The PSF2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GINS2(GINS complex subunit 2 (Psf2 homolog)) The peptide sequence was selected from the N terminal of GINS2. Peptide sequence DAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAIN. |
| Other Names | DNA replication complex GINS protein PSF2, GINS complex subunit 2, GINS complex subunit 2 (Psf2 homolog), HSPC037, PSF2Pfs2 |
| Gene, Accession # | GINS2, Gene ID: 51659, Accession: Q9Y248, SwissProt: Q9Y248 |
| Catalog # | NBP1-58209-20ul |
| Price | |
| Order / More Info | PSF2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |