| Edit |   |
| Antigenic Specificity | Apolipoprotein C-II/ApoC2 |
| Clone | 3E4 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Apolipoprotein C-II/ApoC2 Antibody (3E4) from Novus Biologicals is a mouse monoclonal antibody to Apolipoprotein C-II/ApoC2. This antibody reacts with human. The Apolipoprotein C-II/ApoC2 Antibody (3E4) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | APOC2 (AAH05348, 23 a.a. - 101 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TQQPQQDEMPSPTLLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
| Other Names | APC2, APOC2, Apo-CII, ApoC-II, Apolipoprotein C2, apolipoprotein C-II, MGC75082 |
| Gene, Accession # | APOC2, Gene ID: 344, Accession: AAH05348, SwissProt: AAH05348 |
| Catalog # | H00000344-M01 |
| Price | |
| Order / More Info | Apolipoprotein C-II/ApoC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |