| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AP3M2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The AP3M2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP3M2. This antibody reacts with human. The AP3M2 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: mu-2 |
|---|
| Immunogen | Synthetic peptides corresponding to AP3M2(adaptor-related protein complex 3, mu 2 subunit) The peptide sequence was selected from the middle region of AP3M2 (NP_006794). Peptide sequence VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIID. |
|---|
| Other Names | Adapter-related protein complex 3 mu-2 subunit, adaptor-related protein complex 3, mu 2 subunit, AP-3 complex subunit mu-2, AP47B, CLA20, Clathrin assembly protein assembly protein complex 1 medium chain homolog 2, Clathrin coat assembly protein AP47 homolog 2, Clathrin coat-associated protein AP47 homolog 2, clathrin-associated protein AP47 homolog 2, Golgi adaptor AP-1 47 kDa protein homolog 2, HA1 47 kDa subunit homolog 2, HA1 47kDA subunit homolog 2, mu3B-adaptin, P47B |
|---|
| Gene, Accession # | AP3M2, Gene ID: 10947, Accession: P53677, SwissProt: P53677 |
|---|
| Catalog # | NBP1-56624 |
|---|
| Price | |
|---|
| Order / More Info | AP3M2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 17293072 |
|---|
| 产品资料 |
|
|