| 产品详情 |
| Edit |   |
| Antigenic Specificity | AP1M2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AP1M2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AP1M2. This antibody reacts with human. The AP1M2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to AP1M2 (adaptor-related protein complex 1, mu 2 subunit) The peptide sequence was selected from the N terminal of AP1M2 (NP_005489). Peptide sequence: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL. |
| Other Names | Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2 |
| Gene, Accession # | AP1M2, Gene ID: 10053, Accession: Q9Y6Q5, SwissProt: Q9Y6Q5 |
| Catalog # | NBP1-57035-20ul |
| Price | |
| Order / More Info | AP1M2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|