| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | APLP-2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 25586139). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The APLP-2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to APLP-2. This antibody reacts with human, mouse. The APLP-2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse APLP-2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK |
|---|
| Other Names | amyloid beta (A4) precursor-like protein 2, amyloid precursor protein homolog HSD-2, Amyloid protein homolog, amyloid-like protein 2, APLP-2, APPHCDEI box-binding protein, APPL2, CDEBP |
|---|
| Gene, Accession # | APLP2, Gene ID: 334, Accession: Q06481, SwissProt: Q06481 |
|---|
| Catalog # | NBP1-89029 |
|---|
| Price | |
|---|
| Order / More Info | APLP-2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25586139 |
|---|
| 产品资料 |
|
|