| Edit |   |
|---|
| Antigenic Specificity | Prolyl Oligopeptidase/PREP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Prolyl Oligopeptidase/PREP Antibody from Novus Biologicals is a rabbit polyclonal antibody to Prolyl Oligopeptidase/PREP. This antibody reacts with human. The Prolyl Oligopeptidase/PREP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PREP(prolyl endopeptidase) The peptide sequence was selected from the middle region of PREP. Peptide sequence LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM. |
|---|
| Other Names | dJ355L5.1 (prolyl endopeptidase), EC 3.4.21.26, MGC16060, PE, PEP, Post-proline cleaving enzyme, prolyl endopeptidase, prolyl oligopeptidase |
|---|
| Gene, Accession # | PREP, Gene ID: 5550, Accession: P48147, SwissProt: P48147 |
|---|
| Catalog # | NBP1-56842-20ul |
|---|
| Price | |
|---|
| Order / More Info | Prolyl Oligopeptidase/PREP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|