| Edit |   |
|---|
| Antigenic Specificity | Prolyl endopeptidase-like |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Prolyl endopeptidase-like Antibody from Novus Biologicals is a rabbit polyclonal antibody to Prolyl endopeptidase-like. This antibody reacts with human. The Prolyl endopeptidase-like Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Prolyl endopeptidase-like antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYE |
|---|
| Other Names | EC 3.4.21, EC 3.4.21.-, EC 3.4.21.83, KIAA0436FLJ16627, prolyl endopeptidase-like, Prolylendopeptidase-like, putative prolyl oligopeptidase |
|---|
| Gene, Accession # | PREPL, Gene ID: 9581, Accession: Q4J6C6, SwissProt: Q4J6C6 |
|---|
| Catalog # | NBP2-31868 |
|---|
| Price | |
|---|
| Order / More Info | Prolyl endopeptidase-like Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|