| Edit |   |
|---|
| Antigenic Specificity | Proline Rich 30 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Proline Rich 30 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proline Rich 30. This antibody reacts with human. The Proline Rich 30 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human C2orf53. Peptide sequence PQGKATQACGHQLPASQPPAAQARADPVPGTPSQTRSFRSAGLQSPNSPR. |
|---|
| Other Names | chromosome 2 open reading frame 53 |
|---|
| Gene, Accession # | C2ORF53, Gene ID: 339779, Accession: NP_848648, SwissProt: NP_848648 |
|---|
| Catalog # | NBP1-91464 |
|---|
| Price | |
|---|
| Order / More Info | Proline Rich 30 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|