| Edit |   |
|---|
| Antigenic Specificity | Proline rich 16 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Proline rich 16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proline rich 16. This antibody reacts with human. The Proline rich 16 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to PRR16(proline rich 16) The peptide sequence was selected from the middle region of PRR16. Peptide sequence RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL. |
|---|
| Other Names | DSC54, Mesenchymal stem cell protein DSC54, MGC104614, proline rich 16, proline-rich protein 16 |
|---|
| Gene, Accession # | PRR16, Gene ID: 51334, Accession: Q569H4-3, SwissProt: Q569H4-3 |
|---|
| Catalog # | NBP1-56472-20ul |
|---|
| Price | |
|---|
| Order / More Info | Proline rich 16 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|