| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytochrome P450 2B6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytochrome P450 2B6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytochrome P450 2B6. This antibody reacts with human. The Cytochrome P450 2B6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Cytochrome P450 2B6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EAQCLIEELRKSKGALVDPTFLFHSITANIICSI |
|---|
| Other Names | CPB6, CYP2B, CYP2B7, CYP2B7P, CYPIIB6cytochrome P450, subfamily IIB (phenobarbital-inducible), cytochrome P450 2B6, Cytochrome P450 IIB1, cytochrome P450, family 2, subfamily B, cytochrome P450, family 2, subfamily B, polypeptide 6, cytochrome P450, subfamily IIB (phenobarbital-inducible), polypeptide 6, EC 1.14.14.1, IIB1, P450 |
|---|
| Gene, Accession # | CYP2B6, Gene ID: 1555 |
|---|
| Catalog # | NBP2-57140 |
|---|
| Price | |
|---|
| Order / More Info | Cytochrome P450 2B6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|