| Edit |   |
|---|
| Antigenic Specificity | A2LD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The A2LD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to A2LD1. This antibody reacts with human. The A2LD1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human A2LD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TLEPYPLVIAGEHNIPWLLHLPGSGRLVEGEVYAVDERMLRFLDDFESCP |
|---|
| Other Names | AIG2-like domain 1, AIG2-like domain-containing protein 1, gamma-glutamylamine cyclotransferase, gamma-glutamylaminecyclotransferase, GGACT |
|---|
| Gene, Accession # | GGACT, Gene ID: 87769, Accession: Q9BVM4, SwissProt: Q9BVM4 |
|---|
| Catalog # | NBP2-38064 |
|---|
| Price | |
|---|
| Order / More Info | A2LD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|