| 产品详情 |
| Edit |   |
| Antigenic Specificity | FoxC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. IP reported in scientific literature (PMID: 24840332). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FoxC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FoxC1. This antibody reacts with human. The FoxC1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin. Specificity of human FoxC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YPGQQQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF |
| Other Names | ARA, FKHL7RIEG3, forkhead box C1, forkhead box protein C1, forkhead, drosophila, homolog-like 7, forkhead/winged helix-like transcription factor 7, forkhead-related activator 3, Forkhead-related protein FKHL7, Forkhead-related transcription factor 3, FREAC-3, FREAC3IRID1, IGDA, IHG1, myeloid factor-delta |
| Gene, Accession # | FOXC1, Gene ID: 2296 |
| Catalog # | NBP1-89025 |
| Price | |
| Order / More Info | FoxC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24840332 |
| 产品资料 |
|
|