| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FOX2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FOX2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FOX2. This antibody reacts with human. The FOX2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FOX2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PTTTPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTGEHNLTLYGSTQAHGEQSSNSPSTQNGSL |
|---|
| Other Names | dJ106I20.3, Fox-1 homolog B, fox-1 homologue, FOX2Fox-2, fxh, hexaribonucleotide binding protein 2, Hexaribonucleotide-binding protein 2, HRNBP2FOX-2, RBM9RTAHNRBP2, Repressor of tamoxifen transcriptional activity, RNA binding motif protein 9, RNA binding protein fox-1 homolog 2, RNA binding protein, fox-1 homolog (C. elegans) 2, RNA-binding motif protein 9, RNA-binding protein 9 |
|---|
| Gene, Accession # | RBFOX2, Gene ID: 23543 |
|---|
| Catalog # | NBP1-91910 |
|---|
| Price | |
|---|
| Order / More Info | FOX2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|