| 产品详情 |
| Edit |   |
| Antigenic Specificity | FOPNL |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FOPNL Antibody from Novus Biologicals is a rabbit polyclonal antibody to FOPNL. This antibody reacts with human. The FOPNL Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FOPNL antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IHELNAFEESKDNTIPLLYGILAHFLRGTKDGIQNAFLKGPSLQPSDPSLGRQPSRRKPMDDHLRKEEQKSTNIEDLHVSQ |
| Other Names | C16orf63, chromosome 16 open reading frame 63, DKFZp686N1651, FGFR1OP N-terminal like, FGFR1OP N-terminal-like protein, FLJ31153, FOP-related protein of 20 kDa, FOR20, lisH domain-containing protein C16orf63, PHSECRG2pluripotent embryonic stem cell-related protein |
| Gene, Accession # | FOPNL, Gene ID: 123811 |
| Catalog # | NBP1-84109 |
| Price | |
| Order / More Info | FOPNL Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|