| Edit |   |
| Antigenic Specificity | STARD4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The STARD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to STARD4. This antibody reacts with human. The STARD4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to STARD4 (StAR-related lipid transfer (START) domain containing 4) The peptide sequence was selected from the middle region of STARD4. Peptide sequence CCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEF. |
| Other Names | StARD4, StAR-related lipid transfer (START) domain containing 4, stAR-related lipid transfer protein 4, START domain containing 4 sterol-regulated, START domain-containing protein 4, sterol regulated |
| Gene, Accession # | STARD4, Gene ID: 134429, Accession: Q96DR4, SwissProt: Q96DR4 |
| Catalog # | NBP1-68978 |
| Price | |
| Order / More Info | STARD4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |