| 产品详情 |
| Edit |   |
| Antigenic Specificity | MTUS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MTUS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MTUS1. This antibody reacts with human. The MTUS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
| Immunogen | Synthetic peptides corresponding to MTUS1(mitochondrial tumor suppressor 1) The peptide sequence was selected from the middle region of MTUS1. Peptide sequence KRLSMENEELLWKLHNGDLCSPKRSPTSSAIPLQSPRNSGSFPSPSISPR. |
| Other Names | Angiotensin-II type 2 receptor-interacting protein, AT2 receptor-binding protein, AT2R binding protein, ATBPATIP1, ATIP, DKFZp586D1519, erythroid differentiation-related, FLJ14295, GK1, KIAA1288DKFZp686F20243, microtubule associated tumor suppressor 1, microtubule-associated tumor suppressor 1, Mitochondrial tumor suppressor 1, mitochondrial tumor suppressor gene 1, MP44, MTSG1AT2 receptor-interacting protein, transcription factor MTSG1 |
| Gene, Accession # | MTUS1, Gene ID: 57509, Accession: Q9ULD2, SwissProt: Q9ULD2 |
| Catalog # | NBP1-60099 |
| Price | |
| Order / More Info | MTUS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|