| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | mtTFA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The mtTFA Antibody from Novus Biologicals is a rabbit polyclonal antibody to mtTFA. This antibody reacts with human. The mtTFA Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human mtTFA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAE |
|---|
| Other Names | mitochondrial transcription factor A, MtTF1, mtTFA, TCF-6, TCF6L1, TCF6L2Mitochondrial transcription factor 1, TCF6TCF6L3, Transcription factor 6, Transcription factor 6-like 2, Transcription factor 6-like 2 (mitochondrial transcription factor), transcription factor A, mitochondrial |
|---|
| Gene, Accession # | TFAM, Gene ID: 7019 |
|---|
| Catalog # | NBP2-56077 |
|---|
| Price | |
|---|
| Order / More Info | mtTFA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|