| Edit |   |
|---|
| Antigenic Specificity | ZBED6 C-Terminal Like |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZBED6 C-Terminal Like Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZBED6 C-Terminal Like. This antibody reacts with human. The ZBED6 C-Terminal Like Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to C7ORF29 The peptide sequence was selected from the middle region of C7ORF29. Peptide sequence VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH. |
|---|
| Other Names | chromosome 7 open reading frame 29, hypothetical protein LOC113763 |
|---|
| Gene, Accession # | C7ORF29, Gene ID: 113763, Accession: Q96FA7, SwissProt: Q96FA7 |
|---|
| Catalog # | NBP1-56604-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZBED6 C-Terminal Like Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|