| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL-32 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 25100201). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL-32 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL-32. This antibody reacts with human. The IL-32 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL-32 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCR |
|---|
| Other Names | IL-32, IL-32alpha, IL-32beta, interleukin 32, interleukin-32, interleukin-32 theta, natural killer cell transcript 4, Natural killer cells protein 4, NK4IL-32delta, TAIFa, TAIFb, TAIFc, TAIFd, TAIFIL-32gamma, Tumor necrosis factor alpha-inducing factor |
|---|
| Gene, Accession # | IL32, Gene ID: 9235 |
|---|
| Catalog # | NBP1-82560 |
|---|
| Price | |
|---|
| Order / More Info | IL-32 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25100201 |
|---|
| 产品资料 |
|
|