| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL25 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IL25 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IL25. This antibody reacts with human. The IL25 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IL25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSY |
|---|
| Other Names | chromosome 19 open reading frame 10, EUROIMAGE1875335, IL-25, IL25IL27w, IL27, IL-27, interleukin 25, interleukin 27 working designation, Interleukin-25, R33729_1, SF20hypothetical protein LOC56005, stromal cell-derived growth factor, Stromal cell-derived growth factor SF20 |
|---|
| Gene, Accession # | C19ORF10, Gene ID: 56005 |
|---|
| Catalog # | NBP2-48750 |
|---|
| Price | |
|---|
| Order / More Info | IL25 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|