| Edit |   |
| Antigenic Specificity | CYB5D1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CYB5D1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYB5D1. This antibody reacts with human. The CYB5D1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CYB5D1(cytochrome b5 domain containing 1) The peptide sequence was selected from the middle region of CYB5D1. Peptide sequence KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTEL. |
| Other Names | cytochrome b5 domain containing 1, cytochrome b5 domain-containing protein 1, FLJ32499 |
| Gene, Accession # | CYB5D1, Gene ID: 124637, Accession: Q6P9G0, SwissProt: Q6P9G0 |
| Catalog # | NBP1-56361 |
| Price | |
| Order / More Info | CYB5D1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |