| Edit |   |
| Antigenic Specificity | ZNF286 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF286 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF286. This antibody reacts with human. The ZNF286 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF286. Peptide sequence GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK. |
| Other Names | MGC149627, zinc finger protein 286, zinc finger protein 286A |
| Gene, Accession # | ZNF286A, Gene ID: 57335, Accession: NP_065703, SwissProt: NP_065703 |
| Catalog # | NBP1-80119-20ul |
| Price | |
| Order / More Info | ZNF286 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |