| Edit |   |
|---|
| Antigenic Specificity | ZNF565 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF565 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF565. This antibody reacts with human. The ZNF565 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF565The immunogen for this antibody is ZNF565. Peptide sequence VSQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECREC. |
|---|
| Other Names | FLJ36991, zinc finger protein 565 |
|---|
| Gene, Accession # | ZNF565, Gene ID: 147929, Accession: NP_689690, SwissProt: NP_689690 |
|---|
| Catalog # | NBP1-79419 |
|---|
| Price | |
|---|
| Order / More Info | ZNF565 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|