| Edit |   |
| Antigenic Specificity | ZNF607 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF607 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF607. This antibody reacts with human. The ZNF607 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV. |
| Other Names | FLJ14802, MGC13071, zinc finger protein 607 |
| Gene, Accession # | ZNF607, Gene ID: 84775, Accession: NP_116078, SwissProt: NP_116078 |
| Catalog # | NBP1-80125-20ul |
| Price | |
| Order / More Info | ZNF607 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |