| Edit |   |
| Antigenic Specificity | ZNF547 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF547 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF547. This antibody reacts with human. The ZNF547 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF547. Peptide sequence GTHPEQGLYTCPAHLHQHQKEQIREKLSRGDGGRPTFVKNHRVHMAGKTF. |
| Other Names | FLJ31100, zinc finger protein 547 |
| Gene, Accession # | ZNF547, Gene ID: 284306, Accession: NP_775902, SwissProt: NP_775902 |
| Catalog # | NBP1-80283-20ul |
| Price | |
| Order / More Info | ZNF547 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |