| Edit |   |
|---|
| Antigenic Specificity | ZNF202 |
|---|
| Clone | 1E9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF202 Antibody (1E9) from Novus Biologicals is a mouse monoclonal antibody to ZNF202. This antibody reacts with human. The ZNF202 Antibody (1E9) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | ZNF202 (NP_003446 301 a.a. - 400 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QEPQETQEPEILSFTYTGDRSKDEEECLEQEDLSLEDIHRPVLGEPEIHQTPDWEIVFEDNPGRLNERRFGTNISQVNSFVNLRETTPVHPLLGRHHDCS |
|---|
| Other Names | zinc finger protein 202, ZKSCAN10Zinc finger protein with KRAB and SCAN domains 10 |
|---|
| Gene, Accession # | ZNF202, Gene ID: 7753, Accession: NP_003446, SwissProt: NP_003446 |
|---|
| Catalog # | H00007753-M01 |
|---|
| Price | |
|---|
| Order / More Info | ZNF202 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|