| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF198 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF198 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF198. This antibody reacts with human. The ZNF198 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF198 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RLSFGTVFRHWKKNPLTMENKACLRYQVSSLCGTDNEDKITTGKRKHEDDEPVFEQIENTANPSRCPVKMFECYLSKSPQN |
|---|
| Other Names | FIMRAMPSCLL, Fused in myeloproliferative disorders protein, MYM, Rearranged in atypical myeloproliferative disorder protein, Zinc finger protein 198rearranged in an atypical myeloproliferative disorder, zinc finger, MYM-type 2, ZNF198zinc finger MYM-type protein 2 |
|---|
| Gene, Accession # | ZMYM2, Gene ID: 7750 |
|---|
| Catalog # | NBP1-84685 |
|---|
| Price | |
|---|
| Order / More Info | ZNF198 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|