| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF197 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF197 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF197. This antibody reacts with human. The ZNF197 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF197 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEECEWQVLASQWGNETDERADTVKKVS |
|---|
| Other Names | D3S1363E, P18, VHL-associated KRAB-A domain-containing protein, zinc finger protein 166, zinc finger protein 197, zinc finger protein 20, Zinc finger protein with KRAB and SCAN domains 9, ZKSCAN9VHLaK, ZNF166, ZNF20 |
|---|
| Gene, Accession # | ZNF197, Gene ID: 10168, Accession: O14709, SwissProt: O14709 |
|---|
| Catalog # | NBP2-30999 |
|---|
| Price | |
|---|
| Order / More Info | ZNF197 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|