| Edit |   |
| Antigenic Specificity | ZNF19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF19. This antibody reacts with human. The ZNF19 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ZNF19(zinc finger protein 19) The peptide sequence was selected from the N terminal of ZNF19. Peptide sequence TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE. |
| Other Names | KOX12MGC51021, zinc finger protein 19, zinc finger protein 19 (KOX 12), Zinc finger protein KOX12 |
| Gene, Accession # | ZNF19, Gene ID: 7567, Accession: P17023, SwissProt: P17023 |
| Catalog # | NBP1-53031-20ul |
| Price | |
| Order / More Info | ZNF19 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |