| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF18 |
|---|
| Clone | 2A4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF18 Antibody (2A4) from Novus Biologicals is a mouse monoclonal antibody to ZNF18. This antibody reacts with human. The ZNF18 Antibody (2A4) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ZNF18 (NP_653281 282 a.a. - 380 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PRPTCIGDRQENDKENLNLENHRDQELLHASCQASGEVPSQASLRGFFTEDEPGCFGEGENLPEALQNIQDEGTGEQLSPQERISEKQLGQHLPNPHSG |
|---|
| Other Names | HDSG1Zinc finger protein 535, heart development-specific protein, KOX11Heart development-specific gene 1 protein, Zfp535, zinc finger protein 18, zinc finger protein 18 (KOX 11), ZKSCAN6Zinc finger protein KOX11, ZNF535Zinc finger protein with KRAB and SCAN domains 6 |
|---|
| Gene, Accession # | ZNF18, Gene ID: 7566, Accession: NP_653281, SwissProt: NP_653281 |
|---|
| Catalog # | H00007566-M01 |
|---|
| Price | |
|---|
| Order / More Info | ZNF18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|