| 产品详情 |
| Edit |   |
| Antigenic Specificity | Tripeptidyl-Peptidase I/TPP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Tripeptidyl-Peptidase I/TPP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tripeptidyl-Peptidase I/TPP1. This antibody reacts with human. The Tripeptidyl-Peptidase I/TPP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Tripeptidyl-Peptidase I/TPP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV |
| Other Names | Cell growth-inhibiting gene 1 protein, ceroid-lipofuscinosis, neuronal 2, late infantile (Jansky-Bielschowsky disease), CLN2EC 3.4.14.9, growth-inhibiting protein 1, LPIC, lysosomal pepstatin insensitive protease, Lysosomal pepstatin-insensitive protease, MGC21297, TPP-1, TPP-I, Tripeptidyl aminopeptidase, tripeptidyl peptidase I, tripeptidyl-peptidase 1, Tripeptidyl-peptidase I |
| Gene, Accession # | TPP1, Gene ID: 1200 |
| Catalog # | NBP2-48820 |
| Price | |
| Order / More Info | Tripeptidyl-Peptidase I/TPP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|