| 产品详情 |
| Edit |   |
| Antigenic Specificity | TRIP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRIP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRIP1. This antibody reacts with human, mouse, rat. The TRIP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human TRIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCG |
| Other Names | eIF-3-beta, eIF3-beta, eIF3i, eIF3-p36, EIF3S2TGF-beta receptor-interacting protein 1, Eukaryotic translation initiation factor 3 subunit 2, eukaryotic translation initiation factor 3 subunit I, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa, eukaryotic translation initiation factor 3, subunit I, predicted protein of HQ2242, TGFbeta receptor-interacting protein 1, TRIP-1, TRIP-1eIF3 p36, TRIP1PRO2242 |
| Gene, Accession # | EIF3I, Gene ID: 8668 |
| Catalog # | NBP1-84873 |
| Price | |
| Order / More Info | TRIP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|