| Edit |   |
|---|
| Antigenic Specificity | HIC1 |
|---|
| Clone | 1F2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HIC1 Antibody (1F2) from Novus Biologicals is a mouse monoclonal antibody to HIC1. This antibody reacts with human. The HIC1 Antibody (1F2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | HIC1 (NP_006488.2 627 a.a. - 705 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG |
|---|
| Other Names | hic-1, hypermethylated in cancer 1, ZBTB29hypermethylated in cancer 1 protein, Zinc finger and BTB domain-containing protein 29, ZNF901 |
|---|
| Gene, Accession # | HIC1, Gene ID: 3090, Accession: NP_006488, SwissProt: NP_006488 |
|---|
| Catalog # | H00003090-M05 |
|---|
| Price | |
|---|
| Order / More Info | HIC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|