| Edit |   |
| Antigenic Specificity | HIC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HIC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIC1. This antibody reacts with human. The HIC1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human HIC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT |
| Other Names | hic-1, hypermethylated in cancer 1, ZBTB29hypermethylated in cancer 1 protein, Zinc finger and BTB domain-containing protein 29, ZNF901 |
| Gene, Accession # | HIC1, Gene ID: 3090, Accession: Q14526, SwissProt: Q14526 |
| Catalog # | NBP1-80607 |
| Price | |
| Order / More Info | HIC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |