| Edit |   |
| Antigenic Specificity | HIATL1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HIATL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIATL1. This antibody reacts with human. The HIATL1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human HIATL1The immunogen for this antibody is HIATL1. Peptide sequence GVQKHSNSSSGSLTNTPERGSDEDIEPLLQDSSIWELSSFEEPGNQCTEL. |
| Other Names | FLJ14753, hippocampus abundant transcript-like 1, MGC117350 |
| Gene, Accession # | HIATL1, Gene ID: 84641, Accession: NP_115947, SwissProt: NP_115947 |
| Catalog # | NBP1-79801-20ul |
| Price | |
| Order / More Info | HIATL1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |