| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Ssu72 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Ssu72 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Ssu72. This antibody reacts with human. The Ssu72 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Ssu72 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YDQMYNDLLRKDKELYTQNGILHMLDRNKRIKPRPERFQNCKDLFDLILTCEER |
|---|
| Other Names | CTD phosphatase SSU72, EC 3.1.3.16, FLJ13048, HSPC182, PNAS-120, RNA polymerase II subunit A C-terminal domain phosphatase SSU72, SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae), Ssu72 RNA polymerase II CTD phosphatase homolog (yeast) |
|---|
| Gene, Accession # | SSU72, Gene ID: 29101 |
|---|
| Catalog # | NBP2-49591 |
|---|
| Price | |
|---|
| Order / More Info | Ssu72 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|