| Edit |   |
| Antigenic Specificity | FNDC11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FNDC11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FNDC11. This antibody reacts with human. The FNDC11 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to C20ORF195 The peptide sequence was selected from the N terminal of C20ORF195. Peptide sequence RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV. |
| Other Names | chromosome 20 open reading frame 195, hypothetical protein LOC79025, MGC5356 |
| Gene, Accession # | C20ORF195, Gene ID: 79025, Accession: Q9BVV2, SwissProt: Q9BVV2 |
| Catalog # | NBP1-57700 |
| Price | |
| Order / More Info | FNDC11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |