| 产品详情 |
| Edit |   |
| Antigenic Specificity | FNBP4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FNBP4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FNBP4. This antibody reacts with human. The FNBP4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FNBP4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NGETAIGAENSEKIDENSDKEMEVEESPEKIKVQTTPKVEEEQDLKFQIG ELANTLTSKFEFLGINRQSISNFHVLLLQTETRIAD |
| Other Names | DKFZp686M14102, FBP30, FLJ41904, formin binding protein 4, Formin-binding protein 30, formin-binding protein 4, KIAA1014DKFZp779I1064 |
| Gene, Accession # | FNBP4, Gene ID: 23360 |
| Catalog # | NBP2-14022 |
| Price | |
| Order / More Info | FNBP4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|