| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FNBP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FNBP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FNBP3. This antibody reacts with human. The FNBP3 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FNBP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQDQSVEVSSNTGEETSKQETVADFTP |
|---|
| Other Names | Fas ligand-associated factor 1, Fas-ligand associated factor 1, FBP-11, FBP11Formin-binding protein 11, FLAF1Renal carcinoma antigen NY-REN-6, FLJ20585, FNBP3Huntingtin-interacting protein A, formin binding protein 3, Formin-binding protein 3Huntingtin-interacting protein 10, HIP10HIP-10, HYPAHuntingtin yeast partner A, NY-REN-6, NY-REN-6 antigen, pre-mRNA-processing factor 40 homolog A, Prp40, PRP40 pre-mRNA processing factor 40 homolog A (S. cerevisiae), PRP40 pre-mRNA processing factor 40 homolog A (yeast) |
|---|
| Gene, Accession # | PRPF40A, Gene ID: 55660, Accession: O75400, SwissProt: O75400 |
|---|
| Catalog # | NBP1-87933 |
|---|
| Price | |
|---|
| Order / More Info | FNBP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|