| 产品详情 |
| Edit |   |
| Antigenic Specificity | RRN3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RRN3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RRN3. This antibody reacts with human. The RRN3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human RRN3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV |
| Other Names | DKFZp566E104, RNA polymerase I-specific transcription initiation factor RRN3, RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae), RRN3 RNA polymerase I transcription factor homolog (yeast), TIF-IA, TIFIAMGC104238, Transcription initiation factor IA, transcription initiation factor TIF-IA |
| Gene, Accession # | RRN3, Gene ID: 54700 |
| Catalog # | NBP2-13267 |
| Price | |
| Order / More Info | RRN3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|