| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EGLN2/PHD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EGLN2/PHD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EGLN2/PHD1. This antibody reacts with human. The EGLN2/PHD1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PLSQALPQLPGSSSEPLEPEPGRARMGVESYLPCPLLPSYHCPGVPSEASAGSGTPRATATSTTASPLRDGFGGQDGGE |
|---|
| Other Names | DKFZp434E026, EC 1.14.11, EC 1.14.11.-, egl nine homolog 2, egl nine homolog 2 (C. elegans), EIT6, Estrogen-induced tag 6, FLJ95603, HIF-PH1, HIFPH1 EGL nine (C.elegans) homolog 2, HIF-prolyl hydroxylase 1, HPH-1, HPH-3, Hypoxia-inducible factor prolyl hydroxylase 1, PHD1, Prolyl hydroxylase domain-containing protein 1 |
|---|
| Gene, Accession # | EGLN2, Gene ID: 112398, Accession: Q96KS0 |
|---|
| Catalog # | NBP2-76551 |
|---|
| Price | |
|---|
| Order / More Info | EGLN2/PHD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|